Q: B. Enumerate all the possible DNA nucleotide base sequence for the amino acids given. 4. Met – Leu –…
A: Proteins are polypeptide sequences that are comprised of amino acids. Amino acids are linked…
Q: Explain why a point mutation does not necessarily change the oriignal amino acid sequence. Explain…
A: A mutation refers to the alteration in the sequence of nucleotides in an organism’s DNA…
Q: Determine the mechanism and base change(s) which resulted in the alteration of the sequence of a…
A: In genetics, the mechanism of base change is defined as the change or replacement of DNA single base…
Q: Pyridoxal phosphate (PLP) has the main function of converting one type of amino acid to another…
A: Cofactors are molecules which are needed by enzymes to complete thier activities . Without them…
Q: a. Identify the type of mutation shown below. b. How many amino acids are affected? c. What type of…
A: Mutation - Mutation is defined as the sudden inheritable changes in the structure of the DNA or in…
Q: Does changing the sequence of nucleotides always result in a different amino acid sequence? Explain.
A: Amino acids are molecules that combine to form proteins, They are encoded by specific sequences of…
Q: Explain how amino acid carbon skeletons are degraded once nitrogen is removed.
A: Introduction: The carbon skeletons of the amino acids are transformed into key metabolic…
Q: what has changed in the amino acids sequence?
A: Amino acids and proteins are the building blocks of life. Amino acids are a set of 20 different…
Q: A missense mutation has the potential to alter which level of structure in the protein product?…
A: A missense mutation is a slip-up in the DNA which brings about some unacceptable (wrong) amino acid…
Q: Mutations that change a single amino acid in the activesite of an enzyme can result in the synthesis…
A: A mutation leads to a change in the DNA sequence resulting either due to mistakes during DNA…
Q: Classify the type of mutation that have taken place: silent, missense and nonsense as a result of a…
A: The mutation occurs when there is a change in the nucleic acid sequence. These mutations could be…
Q: 3. A missense mutation results in the presence of a different amino acid than was encoded by the…
A: Sickle cell anaemia is an autosomal recessive disorder.
Q: How Mutations changes the resultant amino acidsequence ?
A: DNA( deoxyribonucleic acid) is the double-stranded molecule that is the genetic material in most…
Q: Find non-cancerous, non--nonsense, point mutation genetic disease. Describe the disease's name and…
A: A point mutation is a mutation that only affects a single nucleotide of nucleic acid. It occurs most…
Q: Determine the effect of the following mutations on the DNA sequence. In each case, the mutation is…
A: The mutation is a process that causes changes in the DNA sequence and that effect the amino acid…
Q: What does the amino acid attach to in the tRNA? CAA tail O ACC tail CCA tail AACtail
A: Translation is the process of protein synthesis. It takes place in the cytoplasm.
Q: a. Identify the type of mutation shown below. b. How many amino acids are affected? c. What type of…
A: Ans a. The type of mutation shown below is point mutaion. A point mutation or replacement is a…
Q: How Amino acids can be covalently modified ?
A: Amino acids are joined together to form protein. Amino acids in a protein can be modified by…
Q: A certain small enzyme is needed to extracellularly digest food. The order of the bases on the DNA…
A: Since you have posted multiple questions, we solve the first question for you. To get the remaining…
Q: If the DNA gene is TAC GGT TTA CAG, which amino acids will be put together?
A:
Q: mino acid sequencing: Determine the amino acid sequence based on the two sets eplace the…
A: By hit and trial method and overlapping different fragments we can obtain the Amino acid sequence of…
Q: Explain how it is feasible to modify an amino acid inside a protein without affecting its function.
A: Proteins are one of the body's most significant macromolecules. These are made up of amino acids…
Q: Discuss how mutations impact protein function. Namely hypothesis the affect these particular…
A: Mutations, variations in a gene's DNA sequence, occur in nature spontaneously. Since alleles are…
Q: among the different types of amino acid substitution, which is the most deleterious one?
A: Mutation is a phenomenon in which some chemical changes occurs in the dna due to some chemical,…
Q: what is the sequence of peptide 4?
A: DNA sequencing is a biochemical method for determining the order of the nucleotide bases, adenine,…
Q: name one kind of mutation that produces an altered protein. what determines wether the altered…
A: Genetic material is nothing but the sequence of nucleic acids which is called as DNA. It contains…
Q: Describe the effect of the substitution mutation in a sequence of amino acids.
A: Mutation is defined as a change in the sequence of DNA that occurs as a result of DNA copying errors…
Q: Mutations in proteins do not always lead to a drastic effect on a protein's function. Substitutions…
A: There are 20 amino acids and all are coded by the triplet codons but the overall proteins structure…
Q: There is only one possible sequence of amino acids when deduced form a given nucleotides. But…
A: Nucleotide refer to a biomolecule composed of phosphate, pentose sugar and nitrogenous base. These…
Q: If the first G changes to A what kind of mutation will happen? Show the change in amino acid…
A: When there is an error in the DNA sequence during replication it causes a change in the DNA…
Q: HbS results from the substitution of valine forglutamic acid at the number 6 position in the b…
A: HbS is the result of a single base-pair mutation in the gene responsible for the beta-globin chain…
Q: Some substitution mutation result in a malfunctioning protein but others do not. Why is this?
A: A mutation is a change that occurs while copying or trying to replicate DNA molecules, resulting in…
Q: Which amino acid metabolism is affected in Alkaptonuria? a. Phenylalanine b. Histidine c.…
A: Alkaptonuria : Autosomal recessive disorder caused by homogentisate 1,2-dioxygenase enzyme…
Q: Select the amino acid sequence that would most likely be located in the interior of a water soluble…
A: Peptides are composed of a linear chain of amino acid sequences attached to each other via peptide…
Q: Determine the identity of the N-terminal amino acid after reconstructing the intact protein. Why is…
A: Introduction:- Amino acids are the building blocks of proteins. The building blocks of life are…
Q: Discuss about Amino Acid Analysis ?
A: The amino acids were considered the organic compounds that form the building blocks of protein.…
Q: Which group is nonpolar and affects gene expression? Which functional group(s) shown above is (are)…
A: Methyl group (-CH3) is nonpolar and it affects the DNA structure by methylation which causes an…
Q: Does changing the sequence of nucleotides always result in a different amino acid sequence? Explain
A: Amino acids are compounds containing carbon, hydrogen, oxygen, and nitrogen. They serve as monomers…
Q: why this position in your protein is important and outline the effects the mutation will have on the…
A: Function of 3GRS: Glutathione acts as an important antioxidant in your body. That means it helps…
Q: Which of these mutations would you predict to be most detrimental? Explain your answer. (Refer to…
A:
Q: =Suggest, which part of these sequence referred to inner core of the otein/ outer core (use single…
A: Hydrophobic: A, C, I, L, M, F, W, V. Neutral: G, H, P, S, T, Y. Hydrophilic: R, N, D, Q, E, K
Q: PLEASE DESCRIBE pKa, pK1, pK2, and pKI, as they relate to amino acid dissociation in solution?
A: Amino acids are most important biomolecules as protein themselves participate in most of the…
Q: Draw a peptide for cys-asn- pro-gly (Using the same format in picture)
A: Proteins are the building blocks of life. Proteins are made up of amino acids. Amino acids when they…
Q: Give the amino acid sequence of each peptide using the fragmentsobtained by partial hydrolysis of…
A: Introduction- Partial hydrolysis can be defined as the water molecule is added to a molecule which…
Q: The biosynthetic pathway for the two amino acides E and H is shown schematically in the Figure…
A: Feedback inhibition is a cellular control mechanism in which an enzyme's activity is inhibited by…
Q: Determine the effect of the following mutations on the DNA sequence. In each case, the mutation is…
A: Mutation is a sudden change on genome which leads to formation of change in mRNA and protein. There…
Q: Determine the effect of the following mutations on the DNA sequence. In each case, the mutation is…
A: The mutation is a molecular process that alter the nucleotide sequence of the DNA. As the mRNA is…
Q: Referring back to the quaternary level proteins, list and describe the modifications that can be…
A: The structure of protein includes sequence of amino acids in a polypeptide chain. The formation of…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- Translate the given amino acid sequence into one-letter code. Glu-Leu-Val-Ile-Ser-Ile-Ser-Leu-Ile-Val-Ile-Asn-Gly-Ile-Asn-Ala-Thr-Leu-Ala-Asn-Thr-Ala Translated code: X IncorrectThe genetic code consists of a series of three-base wordsthat each code for a given amino acid.(a) Using the selections from the genetic code shown below, de-termine the amino acid sequence coded by the following seg-ment of RNA: UCCACAGCCUAUAUGGCAAACUUGAAG AUG= methionine ;CCU= proline; CAU= histidine ;UGG= tryptophan AAG= lysine ; UAU= tyrosine ;GCC= alanine ;UUG= leucine ;CGG= arginine ;UGU= cysteine ;AAC =asparagine ;ACA=threonine ;UCC= serine ;GCA=alanine ;UCA=serine(b) What is the complementary DNA sequence from which this RNA sequence was made? (c) If you were sequencing the DNA fragment in part (b), how many complementary chain pieces would you obtain in the tube containing ddATP?Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?
- Explain why a point mutation does not necessarily change the oriignal amino acid sequence. Explain silent mutations.A sample of a peptide of unknown sequence was treated with trypsin; another sample of the same peptide was treated with chymotrypsin. The sequences (N-terminal to C-terminal) of the smaller peptides produced by trypsin digestion were as follows: Trp-Arg-Thr-Gin Ser-Trp-Arg-His-Trp-Ala-Lys Asp-Val-Ala-Ala-Lys Asn-Ser-Asn-Val-Ile-Arg The sequences of the smaller peptides produced by chymotrypsin digestion were as follows: Arg-His-Trp Arg-Thr-Gin Ala-Lys-Asn-Ser-Asn-Val-Ile-Arg-Trp Asp-Val-Ala-Ala-Lys-Ser-Trp The original peptide sequence was: Asp-Val-Ala-Ala-Lys-Ser-Trp-Ala-Lys-Asn-Ser-Asn-Val-Ile-Arg-Trp-Arg-His-Trp-Arg-Thr-Gin Asp-Val-Ala-Ala-Lys-Asn-Ser-Asn-Val-Ile-Arg-Trp-Arg-Thr-Gin-Ser-Trp-Arg-His-Trp-Ala-Lys Trp-Arg-Thr-Gin-Asn-Ser-Asn-Val-Ile-Arg-Ser-Trp-Arg-His-Trp-Ala-Lys-Asp-Val-Ala-Ala-Lys Arg-His-Trp-Arg-Thr-Gln-Ala-Lys-Asn-Ser-Asn-Val-Ile-Arg-Trp-Asp-Val-Ala-Ala-Lys-Ser-Trp Asp-Val-Ala-Ala-Lys-Ser-Trp-Arg-His-Trp-Ala-Lys-Asn-Ser-Asn-Val-Ile-Arg-Trp-Arg-Thr-Gin…Consider the peptide Asp-Lys-Phe-Glu-Asn-Tyr-Gln-Val-Cys. In a single beaker, you treat this peptide with 2 proteases. One protease cleaves at the N-terminus of aromatic R groups and the other cleaves at the C-terminus of polar, non-ionizable R groups. Following the enzymatic digestion, you want to separate your peptide fragments so that you can identify them. You choose to separate the fragments using an anion exchange column. Beginning at pH=6 you apply your peptide fragments to the column and you gradually decrease the pH of the column stopping the separation when the pH of the column equals 4. Omitting chemical structures, write the amino acid sequence of the peptide fragments that are produced from this digest. Write the order that these fragments will elute from the column (if at all). (Relevant pKa values are: 2.1, 3.8, 4.3, 8.3, 9.6, 10.1, and 10.5)
- The effect of base-pair substitution mutations on protein function varies widely from no detectable effect to the complete loss of a protein function. Why the functional consequences of base-pair substitution vary so widely?Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSAHow the mutations change chemical nature of R group of amino acids? (like polar nonpolar/ charged uncharged) And predict if those changes affect the protein function strongly? Or only weak effects? a)Glutamate to lysine b)asparagine to tyrosine c) aspartate to glutamate thanks
- Using the genetic code table provided below, write out the sequence of three different possible mRNA sequences that could encode the following sequence of amino acids: Met-Phe-Cys-Trp-Glu C A G U C UUU Phe UCU Ser UUC Phe UCC Ser UCA Ser UUA Leu UUG Leu UCG Ser CUU Leu CCU Pro CUC Leu CUA Leu CUG Leu CCG A CAU His CGU Arg CCC Pro CAC His CGC Arg UAU Tyr UGU Cys U UAC Tyr UGC Cys C Stop UGA Stop Stop UGG Trp UAA A UAG G CCA Pro CAA Gln Pro CAG AUU lle AUC lle AUA lle AUG Met ACG G 등등 Gln CGA Arg CGG Arg ACU Thr AAU Asn AGU Ser ACC AAC Asn AGC Ser Thr ACA Thr Thr AAA Lys AGA Arg AAG Lys AGG Arg GUU Val GCU Ala GAU Asp GGU Gly GGC Gly GUC Val GCC Ala GAC Asp GUA Val GCA Ala GAA Glu GGA Gly GUG Val GCG Ala GAG Glu GGG Gly U C A G U C A G SUAUIdentify the primary sequence for the polypeptide that yields these fragments upon treatment: His-met-thr-met-ala-trp; Leu-asn-asp-phe; Val-lys obtained from chymotrypsin Leu-asn-asp-phe-his-met; Ala-trp-val-lys; Thr-met obtained from CNBROn average, how many phosphoanhydride bonds (P;-P; bonds) are directly hydrolyzed in thecourse of synthesizing a 200 amino acid protein? Assume that you begin with the mature mRNA,ribosomal subunits, tRNAs, free amino acids, and all necessary factors.