6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR- WVDIALECERYLAPK 50 -QVILNCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : ":*. :.. Human AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRILYDLD- -ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: Human AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG-----TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What does the (*) mark mean in this alignment result? Evolutionarily conserved region in all the sample Evolutionarily not conserved Similar type of amino acid is present I. I. II. 7. Atriplet of mRNA is called a? a) anticodon b) peptide c) amino acid d) codon
6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR- WVDIALECERYLAPK 50 -QVILNCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : ":*. :.. Human AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRILYDLD- -ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: Human AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG-----TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What does the (*) mark mean in this alignment result? Evolutionarily conserved region in all the sample Evolutionarily not conserved Similar type of amino acid is present I. I. II. 7. Atriplet of mRNA is called a? a) anticodon b) peptide c) amino acid d) codon
Chapter26: Nutrient–gene Interactions In Health And Disease
Section: Chapter Questions
Problem 11RQ
Related questions
Question
Expert Solution
This question has been solved!
Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.
This is a popular solution!
Trending now
This is a popular solution!
Step by step
Solved in 4 steps
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
Recommended textbooks for you