Consider the following GenBank Flat File: /home/jorvis/e_coli_k12_dh10b.gbk It contains a feature table with CDS entries which look like this: CDS 8238..9191 /gene="talB" /locus_tag="ECDH10B_0008" /codon_start=1 /transl_table=11 /product="transaldolase B" /protein_id="ACB01213.1" /db_xref="GI:169887506" /db_xref="ASAP:AEC-0000080" /translation="MTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQ IPEYRKLIDDAVAWAKQQSNDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLS YDTEASIAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFS FAQARACAEAGVFLISPFVGRILDWYKANTDKKEYAPAEDPGVVSVSEIYQYYKEHGY ETVVMGASFRNIGEILELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPARI TESEFLWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDLL" Using a single command, count the number of CDS entries within the file. Provide the command you used as well as the count returned.

Q: What are the four parts of a database system?

A: Introduction: The database system is made up of four major components: Hardware Software Data Data ...

Q: Write a java program to reverse a user entered array in groups. Take the size of group from the user...

A: Hi Dear!! Please Upvote!! Your positive feedback will be more valuable!! ---------------------------...

Q: describe what software engineering is and how it differs from other types of engineering.

A: Introduction: Software engineering is an engineering field dealing with all elements of software cre...

Q: ii) Write a JAVA program to prompt the user to enter a secret message in the form of a string. If th...

A: Code: import java.util.Scanner; class Main{  public static void main(String args[]){       Scanner m...

Q: How do you determine what test cases are appropriate for automation?

A: The main capability of computers are the automation, save the time and labour. It can explain the co...

Q: Question 3 If ao =1, a,=n-an-1+2, find a1, @2, @3 Please write the steps that are required to find t...

A: a0=1, an=n.an-1+2    Put n=1 a1=1.a1-1+2 = 1.a0+2 = 1.1+2=3   Put n=2 a2=1.a2-1+2 = 1.a1+2  = 1.3+2=...

Q: 9. Do Programming Exercise 3 from Chapter 5 using a function grade(score) that returns the letter gr...

A: Functions in python: Functions provide a way to break problems or processes down into smaller and in...

Q: )Σ-p.g), RE = q(p+g)* %3D %3D

A: Here, we are given a regular expression over alphabet set {p, q}. And we are asked to draw a finite ...

Q: Using Java language to Design a game to find the difference between images in Android Studio

A: import java.awt.Color;import java.awt.image.BufferedImage;import javax.imageio.ImageIO;import java.i...

Q: User- and kernel-level threads Using ULTS instead of KLTS has a number of advantages. Could you tell...

A: Disadvantages of the KLT approach for threads implementation are below: 1) Kernel Level Threads are ...

Q: 21. (a) Suppose we are given two sorted arrays A[1.n] and B[1..n]. Describe an algorithm to find the...

A: #include<bits/stdc++.h>using namespace std;#define f(i,x,y) for(int i = (x);i < (y);++i)#de...

Q: Give a recursive definition for an (where n=1,2,3,...) if an=2n+5

A: Below is the recursive definition for an=2n+5: a1=7,a2=9........an=2n+5 Now from above we get : lang...

Q: 3. What are examples of organizations that have equipped to comply with regulatory requirements in ...

A:

Q: Write a java program to reverse a user entered array in groups. Take the size of group from the user...

A: Required:- Write a java program to reverse a user-entered array in groups. Take the size of the grou...

Q: Create an Object-Oriented Programm At least two (2) different Set of OOP

A: As per guidelines, we can solve one question at a time.Hence resubmit the question for further answe...

Q: Which one of the following is the built-in database in android? O a. Java O b. MS Access O c. SQL O ...

A: I have answered all the 3 parts. First we will see which one is the built-in database in android.The...

Q: The infix string require to store in linked List using following structure typedef enum TokenType {...

A: Let's see the solution  in the next steps 

Q: Create a C program that do exactly the same as the sample below

A: #include <stdio.h>#include <string.h>// horizontal linechar dline[] = "=================...

Q: What is the distinction between Python and JavaScript programming?

A: Introduction: javascript It is a web programing language. it is a cross-platform language. Its code...

Q: How can the repeated calls to itself in a recursion function be managed? What kind of control system...

A: A function calling itself is called as Recursion function. In these type of functions, the logic for...

Q: Question 4 Why must the single-cycle datapath have separate instruction and data memories? The forma...

A: answer is 

Q: Which of the many network topologies would you recommend?

A: Below find the solution  

Q: Use an example to explain how business can better utilize disruptive and sustaining technologies for...

A: -innovation and technology plays vital role in modern bussiness and the working world. -the modern e...

Q: A) Create a super (parent) class called Course. The Course class represents any course that does not...

A: NOTE: Programming language is not mentioned, so I am doing in JAVA In this question, there are three...

Q: Create a JavaScript Arrow function that meets the following requirements: Authored using arrow expre...

A: // arrow function of _replaceCharacterconst _replaceCharacter = (string) => { let ans = ""; // in...

Q: What do you believe were the technological and political implications of the Soviets copy of the B-2...

A: In questions with many questions, we must answer the first.

Q: What are smart pointers, exactly? What purpose do they serve?

A: Introduction: A Smart Pointer is a pointer wrapper class with overloaded operators such as * and -&g...

Q: White balance : a) Produces a better resolution b) Insures the colors are correct c) Has a temperatu...

A: Introduction:                           White balance (WB) is the act of removing unnatural colour ...

Q: Controls and Methods What controls are possible as parameters for fade, hide, and toggle?

A: The above methods which are in the question are from jQuery(which is basically a javascript library)...

Q: Using C program. Create an array of 15 integers, asking input from users. Determine the sum of all n...

A: Step 1 : Start Step 2 : Create an array of numbers with size = 15. Step 3 : Define the variables to ...

Q: Make a C program to input n numbers and will output (a) the sum of all positive odd integers, (b) th...

A: Here is the approach:- First take input from the user for the number of integers and then create th...

Q: tion. Often they indicate sequence-specific binding sites for proteins and other important markers. ...

A: The solution of the following question is:     CODE 1: class DNAMOTIF:...

Q: e forefront of Artificial Intelligen

A: AI ethics is a set of moral principles and techniques aimed at guiding the development and responsib...

Q: Given that x=2 and y=- 6, what is the output of this code If (x>1  &&  y<x-5) { If (x || y) x = ...

A: - We have to get the output of the provided code with explanation as to how we reach it.

Q: This program will calculate the refined average of a list of numbers. Refined average means from a l...

A: Code is in the next step:  

Q: Is it feasible to raise a runtime error but not catch it?

A: The short answer YES.  

Q: Drawing Things Out Consider an array of integers: 2, 4, 5, 9, 11, 13, 14, 16 Draw out how the array ...

A:

Q: What is manifest XML in android? а. It has information about the application O b. It has information...

A: What is Android Menifest ?                         An Android Manifest would be an XML file that inc...

Q: This kind of data transmission allows data to be delivered in both directions on a signal carrier at...

A: As we know that the full duplex as mentioned is a data transmisssion which can transmit data in both...

Q: Python :Using the Positional List, write a code that asks the user to enter the words, insert the wo...

A: import bisect  print("Enter words for the list, \"exit\" to quit")lst = []while True:    x = input()...

Q: 11. Input three integers x, y, and z, and then check whether the numbers form a valid Pythagorean tr...

A: Required:- 11. Input three integers x, y, and z, and then check whether the numbers form a valid Pyt...

Q: What does it mean to have "knowledge"? and how is "knowledge" represented in the realm of computers?...

A: Knowledge is the ability to recognize truths that have been gained through education and experience.

Q: Program to input the elements(integer type) of a array of size 17 and check if all the elements of t...

A: Return true before checking all the elements of the array.  Counter to count the number of odds or e...

Q: a) Mention what Model-View-Controller represents in an MVC application of your choice with prope ill...

A: The Handwritten answer is below:

Q: When is it advisable to deploy Brouter on your network?

A: Introduction: The rapid advancement of technology will render conventional network designs incapable...

Q: What is a data warehouse and what are its advantages and disadvantages? What is the data warehouse's...

A: Introduction: A data warehouse (DW or DWH), sometimes known as an enterprise data warehouse (EDW), i...

Q: 5. Suppose you have a set of proposed activities along with start time a; and finish time f, where 0...

A: * This question is based on greedy algorithm * consider this table as a list containing start time( ...

Q: Which type of image is best for a 3-D video game? Why?

A: A video game also known as computer game is an electronic game that involves interaction with a user...

Q: Given an input string, delete recursively all the duplicate adjacent characters and return a string ...

A: Hello student, hope you are doing good. In this question, as the coding langauge is not mentioned so...

Q: Determine whether each of these functions is a bijection from R to R a. ?(?) = −3? + 4 b. ?(?) = −3?...

A: