Answered: Which of the following peptide…

Which of the following peptide sequences is most likely to be found in a hydrophobic pocket of the protein containing it DEAD AVGF ACMN GSYK

Biology Today and Tomorrow without Physiology (MindTap Course List)

5th Edition

ISBN:9781305117396

Author:Cecie Starr, Christine Evers, Lisa Starr

Publisher:Cecie Starr, Christine Evers, Lisa Starr

Chapter7: Gene Expression And Control

Section: Chapter Questions

Problem 2CT

See similar textbooks

Related questions

Q: There is a "primary driving force" behind protein folding (to form tertiary structure). This driving…

A: Proteins are the monomers of amino acids that have a chiral or an alpha carbon with all four groups…

Q: Which peptide sequence is most likely to be found within the inner core of a globular protein?…

A: Biochemistry is a branch of science that deals with the study of chemical processes related to the…

Q: The fi broin proteins found in silk fi bers consist of large regions of β-pleated sheets stacked one…

A: Beta pleated sheet is a common motif of the regular protein secondary structure.

Q: Two peptide segments are shown below. Predict which one would have the most negative AG when going…

A: Protein folding is a spontaneous reaction by which most of the proteins fold inside the cell without…

Q: You have isolated a new protein called STICKY. You can predict from comparisons with other known…

A: Proteins are essential nutrients for the human body. They are one of the building blocks of body…

Q: What is the difference between the two salt precipitation methods: salting in and salting out?…

A: The solubility of a protein in solution depends on the concentration of the salt present in…

Q: You have isolated a new protein called STICKY. You can predict from comparisons with other known…

A: This motif is formed by two alpha helix connected by a loop. Dimeric transcription factors usually…

Q: What is the most probable location of each amino acid below in a globular protein. i = interior s =…

A: Trimethyl lysine is a non-natural amino acid. Cysteine and asparagine are natural amino acids.

Q: The solid black line represents the backbone of the protein. Functional groups 1 and 2 are [ Select]…

A: Q. The solid black line represents the backbone of the protein. Functional groups 1 and 2 are •…

Q: A peptide with 19 amino acid residues was digested with trypsin and generated the following…

A: The one letter code for different amino acids are :- G - glycine I - isoleucine R - arginine S -…

Q: In the amino acid sequence below, the amino acid residue in red was shown to be essential to the…

A: Peptides or proteins are composed of twenty standard amino acids. These standard amino acids differ…

Q: A protein that is normally found in an aqueous solution has these amino acids in its primary…

A: Proteins are composed of the linear chain of amino acid sequences attached via peptide bonds.…

Q: Which peptide would absorb the most UV light at 280nm? (Can you show work because I mainly want to…

A: Aromatic amino acids are relatively non polar. All aromatic amino acids such as tyrosine,…

Q: Regions of 2 receptors that interact on dimerization are shown below. Identify the types of…

A: Answer: Introduction:Multiple amino acids are connected by different bonds like peptide bonds and…

Q: you have isolated a new protein called STICKY. you can predict from comparisons with other known…

A: A new protein named "STICKY" is isolated, which possesses a specific region in its structure. These…

Q: Which of the following polypeptides is the most hydrophobic? Val Met Pro Gly Trp lle Leu Ala Gly Met…

A: Proteins are large biomolecules that compose structural and motor elements of a cell, and also as…

Q: The protein will lose its conformation when denatured by some factors such as a big change in pH and…

A: Denaturation: It is defined as the change of conformation protein and its physical properties. This…

Q: Peptide bond is /has ……………. This structural feature prevents protein to sample all possible…

A: In proteins, different amino acids are joined by the formation of peptide bond which is formed…

Q: Of the following amino acids, which 3 are most likely to be found on surface of a single protein.…

A: Proteins are the ultimate products of the genes. DNA is transcribed into m RNA and this is…

Q: The sequence of a peptide is given below. Ala-gly-val-leu-trp-lys-ser-phe-arg-proWhich peptide…

A: Chymotrypsin belongs to a group of enzymes that all use a serine as an active site to cleave peptide…

Q: What is the overall charge on peptide AVGDWESKELLE at pH 7.0? a. -3 b. -2 c. 0 d. +1 Which of…

A: The overall charge on a peptide depends upon the charge of the functional group like NH2 group, COOH…

Q: A certain protein is used to activate myosin. If the protein is treated with B-mercaptoethanol, it…

A: Proteins are biomolecules made up of amino acid chains arranged in three-dimensional and…

Q: Mutations in proteins do not always lead to a drastic effect on a protein's function. Substitutions…

A: There are 20 amino acids and all are coded by the triplet codons but the overall proteins structure…

Q: Calculate the pI of both peptides. Which is more acidic and why?

A: Given sequence, PEPTIDE #1: Pro-Phe-Thr-Cys PEPTIDE #2: Gly-Tyr-Ser-Asp If the peptide does not have…

Q: You have discovered a novel protein that has a pI = 5.5. To study the functional properties of this…

A: Isoelectric Point (pI) is a condition at a particular pH where the amino acid is present in the…

Q: You have discovered a novel protein that has a pI = 5.5. To study the functional properties of this…

A: The functional properties of the new protein, has two amino acid changes—namely, a surface Phe…

Q: The folding of some protein was monitored as a function of the time it takes for the protein to…

A: The proteins can be modified by different modifications and this modification can affect the…

Q: A protein that is normally found in an aqueous solution has these amino acids in its primary…

A: Proteins are composed of different amino acids with different chemical nature. Amino acids are…

Q: Determine the identity of the N-terminal amino acid after reconstructing the intact protein. Why is…

A: Introduction:- Amino acids are the building blocks of proteins. The building blocks of life are…

Q: For the peptide Ala-Cys-His-Ile-Leu-Asp a. Write the single letter code for the amino acid residues…

A: A peptide is a compound which consists of two or more amino acids which are linked in a chain where…

Q: Which peptide in below pair has side chains that exhibit predominantly van der Waals forces?…

A: Proteins/peptides fold with the help of van der Waals forces. The significant types of van der waal…

Q: In SDS-PAGE. What chemical is used to ensure that all protein molecules are coated with a negative…

A: Ans SDS

Q: For a peptide with a sequence listed below. Lys-Gln-Val-Arg-Glu-Phe-His-Asn-Asp-Tyr 1) Estimate the…

A: Peptides are short strings of amino acids, typically comprising 2-50 amino acids. Amino acids are…

Q: Estimate the mass of a protein that is 100 residues in length. 6,000 amu 11,000 amu 20,000 amu 9,000…

A: Proteins or polypeptide contains amino acids. The mini acids present in a protein can be polar,…

Q: Draw the bond-line structure of the given peptides. 1. Ser-Asp 2. Glu-Gln 3. Arg-His

A: Bond line structure of the amino acids reveals the covalent bonding, hydrogen bonding and peptide…

Q: 6. Shown below are the amino acid sequences of the wild-type and three mutant forms of a protein.…

A: Hello. Since your question has multiple sub-parts, we will solve first three sub-parts for you. If…

Q: In most cases, mutations in the core of a protein that replace a smaller nonpolar side chain in the…

A: Cells have aqueous environment that is hydrophilic. So, proteins fold in a way that the hydrophilic…

Q: A peptide has the following sequence: Gly-Ala-Lys-Phe-Asp-Met-Val-Pro-Arg-Ala-Leu. What is the net…

A: The amino acids contain ionizable groups. The ionic form and charge of the amino acids depend upon…

Q: A protein has an asp glu/arg lys ratio of 3. What would the overall charge on this molecule likely…

A: Amino acids are the monomers of the peptide or proteins having different side chains attached to the…

Q: Theoretical and experimental data show that in many cases the ionic and hydrogen-bonding…

A: Proteins are made up of monomeric units of amino acids (primary structure). The polypeptide chains…

Q: a) The pl of a protein is 9.0. What will be the net charge (positive, negative or neutral) on the…

A: Proteins are macromolecules that are formed by several amino acids. Amino acids carry different…

Q: Which of the peptide sequences below best matches the hydropathy plot shown? L 10 Residue Number 4 2…

A: Hydrophobicity plot analyzes the amount of the hydrophobicity and the hydrophilicity that is present…

Q: The following sequence is part of a globular protein. Predict the secondarystructure in this…

A: Protein or peptides are composed of a linear chain of amino acid sequences attached via peptide…

Q: In this peptide the amino terminus is the amino Cys-Ala-Gly-Arg-Gln-Met acid a.arg b.Cys

A: "Since you have asked multiple question, we will solve the first question for you. If you want any…

Q: A peptide containing 18 amino acid residues in its sequence was partially hydrolyzed and peptides…

A: Amino acids are biomolecules which contains a basic amine group, an acidic carboxyl group, an…

Q: What is the key driving force for forming stable 3D structures of proteins (e.g., the coronavirus…

A: 3-D structures of proteins are the tertiary and quaternary protein structures that are the final…

Q: pu've isolated a novel protein, but you believe what you actually have is mixture of the unmodified…

A: All the techniques described above in the options use one or more criteria to separate the protein…

Q: Which of the following statements best describe(s) the mechanism by which correct protein folding…

A: Answer :- Step 1 proteins are one of the macromolecules present in the living organism. They…

Concept explainers

Osmosis

In simple words, osmosis is the slow, gradual movement of a liquid through a membrane. But there are nuances to this process. For instance, there has to be an imbalance in the distribution of solute in the liquid on either side of the membrane, which has to be semipermeable. The liquid in the region with a lower solute concentration moves to the region with a higher concentration, thereby displacing the solution in the process. The objective is to equalize the concentration of molecules on both sides of the membrane; the displacement of liquid can be viewed as a byproduct of this equalization. Since there is no energy required to carry osmosis, it is considered a passive process.

Question

Which of the following peptide sequences is most likely to be found in a hydrophobic pocket of the protein containing it

DEAD
AVGF
ACMN
GSYK

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.

Similar questions

Which of the following peptides will likely form a loop or turn in a protein and explain why
On average, how many phosphoanhydride bonds (P;-P; bonds) are directly hydrolyzed in thecourse of synthesizing a 200 amino acid protein? Assume that you begin with the mature mRNA,ribosomal subunits, tRNAs, free amino acids, and all necessary factors.
Given the following sequence present within a large, soluble, globular protein: N-Asn Tyr Ser His Gly Asp Arg Tyr Thr lle Leu Leu Met Glu His Glu Phe Ile Val Pro Gly Pro Phe Thr Val Glu Val Asn -C What secondary structural elements are most likely present in this sequence? Please annotate the sequence to show where these structures begin and end.
Remembering that the amino acid side chains projecting from each polypeptide backbone in a β sheet point alternately above and below the plane of the sheet, consider the following protein sequence: Leu-Lys-Val-Asp-Ile-Ser-Leu-Arg- Leu-Lys-Ile-Arg-Phe-Glu. Do you find anything remarkable about the arrangement of the amino acids in this sequence when incorporated into a β sheet? Can you make any predictions as to how the β sheet might be arranged in a protein?
Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA
Loop regions play important roles in the secondary structure of protein. Define loop region and give three (3) of the roles
Both hsp60-like and hsp70 molecular chaperonesshare an affinity for exposed hydrophobic patches on pro-teins, using them as indicators of incomplete folding. Whydo you suppose hydrophobic patches serve as critical sig-nals for the folding status of a protein?
The folding of intrinsically disordered proteins is prevented by the presence of Ser, Lys, and Glu residues. What do these amino acids have in common? Why do they disrupt IDPs?
Provide the number of polypeptide chains present andthe number of amino acid residues in each chain. for https://www.rcsb.org/structure/6j20 Provide the molecular weight of the protein orprotein complex and the total number of atoms. (All of this information can be found in the PDBpage.) Create a figure (available in the PDB page) that shows the topology of your protein, i.e.the secondary structures adopted by different regions of the protein (alpha helix, beta strand).Make sure to also provide a figure legend that helps interpret the figure and appropriate figurecaption that briefly explains the figure.
Synthesis of peptide bonds is [exorgonic or endergonic]. Thus in isolation, this reaction would [occur or not occur] in cells. Peptide synthesis at the ribosome is coupled to GTP hydrolysis which is an [exergonic or endergonic] process thus making the overall process of synthesizing peptides [spontaneous or not spontaneous].
Consider the following peptide: Lys-His-Asp-Glu-Phe-Cys-Ala-Asp-His-Arg What is the net charge of this peptide at pH = 1? What is the net charge of this peptide at pH = 14?
A small protein has a sequence ACNCKAAPMLCARYCAMLH. The structure of this single peptide is stabilized by the formation of two separate disulfide bonds, but the locations of those disulfide bonds are unknown. In order to determine the location, you purify this peptide and treat it with trypsin (cleaves peptide bond at long, positively-charged side chains). Tryptic digestion generated two peptides. Based on this result, determine the location of the –S-S– bonds. Show them in a diagram on the sequence by connecting the corresponding residues. Explain your reasoning.