Essentials of Genetics (9th Edition) - Standalone book
9th Edition
ISBN: 9780134047799
Author: William S. Klug, Michael R. Cummings, Charlotte A. Spencer, Michael A. Palladino
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Textbook Question
Chapter 1, Problem 9PDQ
How many different proteins, each with a unique amino acid sequence, can be constructed with a length of five amino acids?
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
What are the sequences of all the possible tripeptides that contain the amino acids, serine, leucine and phenylalanine? Use 3-letter abbreviations to express your answer.
HOW MANY DIFFERENT
PROTEINS CAN BE
CONSTRUCTED
THAT ARE
EXACTLY FOUR AMINO ACIDS
LONG? (HINT: THERE ARE 20
POSSIBLE AMINO ACIDS.)
A monomeric protein contains 154 amino acids. How many codons code for these amino acids? How many nucleotides?
Chapter 1 Solutions
Essentials of Genetics (9th Edition) - Standalone book
Ch. 1 -
1. Describe Mendel’s conclusions about how...Ch. 1 -
2. Review the Chapter Concepts list on p. 1....Ch. 1 - What is the chromosome theory of inheritance, and...Ch. 1 - Prob. 4PDQCh. 1 -
5. Given the state of knowledge at the time of...Ch. 1 - Contrast chromosomes and genes.Ch. 1 - How is genetic information encoded in a DNA...Ch. 1 - Describe the central dogma of molecular genetics...Ch. 1 - How many different proteins, each with a unique...Ch. 1 - Outline the roles played by restriction enzymes...
Ch. 1 - What are some of the impacts of biotechnology on...Ch. 1 - Prob. 12PDQCh. 1 - We all carry about 20,000 genes in our genome. So...Ch. 1 - How has the use of model organisms advanced our...Ch. 1 - If you knew that a devastating late-onset...Ch. 1 -
16. Why do you think discoveries in genetics...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- You have discovered a novel protein that has a pl = 5.5. To study the functional properties of this new protein, your research group has made a mutant that contains two amino acid changes: a surface phenylalanine residue in the normal protein has been replaced by histidine (side chain pK, = 6.1), and a surface glutamine has been replaced by glutamic acid (side chain pK, = 6.0). Is the pl of the mutant protein predicted to be greater than, less than, or the same as the pI of normal protein? Support your answer with the appropriate calculation.arrow_forwardMost proteins contain more than 100 amino acid residues. If you decided to synthesize a “100-mer,” with 20 different amino acids available for each position, how many different molecules could you make?arrow_forwardIf an average amino acid is 110Da, how many amino acids would you predict to have in a polypeptide that is 65,000 Daltons in size? How many nucleotides would this be if you were looking for the gene size?arrow_forward
- How long (Å) is an alpha helix of 16 amino acid residues?arrow_forwardA researcher isolates a new protein and finds that it contains 0.755% serine by weight upon amino acid analysis. The molecular mass of serine is 105 g.mol-¹. What is the minimum molecular mass for the protein assuming only one Ser residue per protein molecule? mmin = The researcher estimates the molecular mass of the protein using gel electrophoresis. From this estimated molecular mass, the researcher concludes the protein contains 3 Ser residues. What is the estimated molecular mass of the protein as shown by gel electrophoresis? g.mol-¹ mest = g.mol-1arrow_forwardYou are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280?? or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280??? Select the best answer. Measuring absorbance at higher wavelengths, like 595?? or 562??, is more accurate than measuring absorbance at…arrow_forward
- What are the sequences of all the possible tripeptides that contain the amino acids aspartic acid, leucine, and phenylalanine? Use the threeletter abbreviations to express your answer.arrow_forwardHow many amino acids are in a 62 Angstrom long Alpha helix?arrow_forwardRefer to the figure below. Replacing lysine with another amino acid in the protein may alter the shape and function of the protein. Replacing lysine with which type(s) of amino acid(s) would lead to the least amount of change in the tertiary structure of this protein? Explain.arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage Learning
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
QCE Biology: Introduction to Gene Expression; Author: Atomi;https://www.youtube.com/watch?v=a7hydUtCIJk;License: Standard YouTube License, CC-BY