Q: compensation in genetics
A: Genetics is subfield of biology. It deals with the study of genetic variations and heredity in…
Q: The Human Genome Project was created in 1990 as an international effort began to analyze the human…
A: The Human Genome Project was an international scientific research project with the aim to determine…
Q: (20)Genetic engineering utilized to create food sources has been said to be both like and unlike…
A: Genetic engineering is a biotechnological application that enables the development of genetically…
Q: B. Shiga toxin (Stx) is a potent A-B toxin that inhibits protein synthesis and has a lethal dose 50…
A: Shiga toxin (Stx) is the most potent biological poison found in Shigella dysenteriae 1 and in some…
Q: Select the TRUE statement about genetic engineering?" A. The process of direct manipulating of an…
A: Introduction Genetic engineering is the process of altering an organism's genetic makeup using…
Q: Give at least three (3) importance of these tools in genetic engineering in the advancement of cell…
A: Genetic engineering is the bran of biological sciences that deals with the methods and applications…
Q: E. How many nucleotides would be required to generate a polypeptide that is 15 amino acids long?…
A: The genetic code is a sequence of three-letter combinations of nucleotides called codons, each…
Q: Red blood cells and muscle cells look very different and have different functions. Using the…
A: The cell is the essential underlying, utilitarian, and natural unit of every known creature. Cells…
Q: A. Which genetic modification do you think each of the plant crops below has undergone? Write the…
A: Genetically Modified Organisms (GMO) are currently in use in the world. The plants and animals are…
Q: Tamoxifen needs an enzyme that is not found in the genes of Asians, but is used to prevent breast…
A: Tamoxifen-- Tamoxifen is a class of medication known as antiestrogen , which blocks the activity of…
Q: Imagine that you travel around the world and find two populations of fish that look very similar,…
A: Introduction Variation among animals can be due to the genetic effects or can be due to the…
Q: A. What do scientists do to adult cells to make them “behave” like embryos? B. Transgenic, cloned…
A: The embryo is formed from the fusion of the male gamete and the female gamete in the process of…
Q: Please use information from the text below and your knowledge of biology to answer the final two (2)…
A: A genome is an organism complete set of DNA, a chemical compound that contains genetic instructions…
Q: Genetic Engineering is being used by the pharmaceutical industry. Which of the following is NOT…
A: Genetic engineering is the process of modifying an organism of a genetic level- for example,…
Q: A student wants to observe how the environment of bacteria affects gene expression. How should the…
A: Option B i.e. exposing same species of bacteria to the different carbohydrate in each sample is the…
Q: ) Why is it possible for you to study the eye colour gene by extracting cheek cells? a. Because…
A: Introduction: Cell is the smallest structural and functional unit of an organism, consisting of…
Q: Which of the following is NOT a genetically engineered animal? Lütfen birini seçin: O a. Sheep…
A: Most of the options given above are animals produced trans-genetically. Transgenetic animals are…
Q: bout a high molecular weight protein that cannot be transported into the nucleus? A. It…
A: The protein's entry into the cytoplasm and nucleus is critical in the cell's various physiological…
Q: Insulin is a peptide hormone encoded by the INS gene, which is on chromosome 11. Insulin is produced…
A: The hormone insulin is required by the body to reduce the level of blood glucose. The pancreatic…
Q: what does this suggest. b) suggest a macromolecule where this modification might occur
A:
Q: If you see an elephant and a silkworm, what can you know about the relative size of their genomes?
A: There is no relationship between the physical size of organism and it's genome size or number of…
Q: Comparative genomicsa. is the application of computer technologies to the study of thegenome.b. is…
A: Comparative genomic is the field of biological research in which the genomic features of different…
Q: Which parameters are important to include when designing a GWAS (genome-wide association study) to…
A: For the purposes of genetic studies, SNPs are typically used as markers of a genomic region, with…
Q: a. Why does a shift from grain to meat diets create more demand for cereals? b. What is the name of…
A: Cereals are the very important supple edible part of grain. The edible half is reproductive…
Q: A geneticist interested in immune function induces random mutations in a number of specific genes in…
A: Genetics is a branch of biology which is concerned with the study of genetic variation, genes, and…
Q: e. You also study the expression of 2 different mutants for this gene. For each mutant answer the…
A: ORF stands for open reading frame. It is found between the start and stop codon.
Q: The introduction to this chapter describes the long-term effects of famine on people conceived…
A: Dutch hunger winter refers to the extreme scarcity of food in the Netherlands during the end of…
Q: What was the main goal of Human Genome Project? Lütfen birini seçin: O a. Identify mutated genes in…
A: Human genome project is an international scientific research project which was completed in year…
Q: Biology The lab responsible for genotyping the hair color of the subject is taking forever. When you…
A: Single nucleotide polymorphism refers to the germline substitution at a particular position in the…
Q: Which statement about the genes of specialized cells is true? O A. The specialized cells of an…
A: Totipotent cells are those cells that can differentiate into any type of cells that also includes…
Q: ion d)DNA that provides instructions for building a protein e)DNA that provides the instructions…
A: Gene is physical and functional unit of heredity. DNA that provides instructions for building a…
Q: The type of model building used by Pauling and by Watson andCrick involved the use of ball-and-stick…
A: Molecular modelling is the collection of all theoretical methods and computational techniques that…
Q: You are studying a protein that you observe to be located in the ER and Golgi. You hypothesize that…
A: Introduction :- ER and Golgi are membrane bound organelles, which are present in the cytoplasm of a…
Q: Suppose that you could undergo genetic testing at age 18 for susceptibility to a genetic disease…
A: Genetic diseases are caused due to mutations in the genes that are acquired from the parents or can…
Q: Which statements are associated with positively cooperative oxygen binding of a protein? A. The…
A: Haemoglobin is a tetrameric protein. It is a heterotetramer consisting of two alpha subunits and two…
Q: Why do we utilize micropipettes when dispensing volumes in cell/molecular biology labs? a They are…
A: Biology is a branch of science. Bio means life and ology means study. Biology is basically the study…
Q: Describe the three basic goals of the Human Genome Project. What are at least three things we have…
A: The HUMAN GENOME PROJECT was a 13-year plant which was proposed by Frank Collins and Roderick. Thee…
Q: Most scientists consider the Human Genome Project (HGP) to be the most significant scientific…
A: A genome is the complete collection of deoxyribonucleic acid ( DNA) for an organism, a chemical…
Q: You hope to study a gene that codes for a neurotransmitter protein produced in human brain cells.…
A: Hello. Since your question has multiple sub-parts, we will solve first three sub-parts for you. If…
Q: Would the horse make a good model genetic organism? Why or why not?
A: Genetics is the study of genes with the goal of understanding what they are and how they function.…
Q: Sickle Cell Anemia Sickle cell anemia is the result of a type of mutation in the gene that codes for…
A: Hemoglobin is a pigment protein which helps in carrying out oxygen amd transport them to all part of…
Q: e. You also study the expression of 2 different mutants for this gene. For each mutant answer the…
A: Translation is the process of synthesis of protein from the mRNA in the cytoplasm.
Q: Which region on the following Ramachandran Plot corresponds to the allowable region(s) for Pro? J…
A: The Ramachandran plot is a plot between the torsional angles of the amino acids in a peptide. The…
Q: Parents who both have "sickle-cell trait", i.e, are heterozygous for HbS have a child who is tested…
A: Sickle cell anemia is a blood disorder in which a mutation in one the hemoglobin genes causes the…
Q: e. You also study the expression of a different mutants for this gene. For each mutant answer the…
A: Translation is the process of synthesis of protein from the mRNA in the cytoplasm of cell.
Q: Are the following examples a description of genetics at the molecular, cellular, organismal, or…
A: The branch of science which is concerned with the study of genes is known as genetics. It involves…
Q: Think about the effects of the two different water treatments. Do you think the water itself was…
A: Conceptual Introduction Two different water treatments with two different conditions can denature…
Q: Briefly explain how Genome Wide Association Studies (GWAS) are done. Then, using this example of a…
A: A genome-wide association study (GWAS) is a methodology utilized in hereditary qualities examination…
Q: A scientist analyzed the bases in a segment of DNA from a human skin cell to determine if it codes…
A: The DNA base pairs are formed by the bonding of purines with pyrimidines by hydrogen bonds. The…
How many genes in the human genome code for lipids instead of proteins?
A. 0
B. Approx. 1000
C. 118
D. 25,000
E. Approx 5000
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- 30. The following figure shows an electrophoretic analysis of the hemoglobin proteins present in normal adults, newborns, and fetuses. Each band represents a complete hemoglobin protein with all of its subunits. The intensity of the band indicates the relative amount of that protein in the sample. Y Adult Newborn Fetus a. What is the subunit structure of the hemoglobin molecules marked X, Y, and Z? b. Name one abnormal condition that should increase the percentage of HbZ hemoglobin in a newborn. c. Name one abnormal condition that should increase the percentage of HbY hemoglobin in an adult.Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?A small section of a gene for a protein has the following nucleotide sequence: TAT CTG GCT GTC CAAWhich of the following mutations would cause a missense mutation in the sequence shown above? Select one: a. Replacement of second thymine base with cytosine base b. Replacement of second guanine base with thymine base c. Replacement of last adenine base with guanine base d. Replacement of first guanine base with adenine base
- A small section of a gene for a protein has the following nucleotide sequence: GCT CTA GCT ATC TGA Which of the following mutations would cuase a silent mutation in the sequence shown above? a. Replacement of second adenine base with thymine base b. Replacement of first thymine base with adenine base c. Replacement of second guanine base with cytosine base d. Replacement of first cytosine base with guanine baseA small section of a gene for a protein has the following nucleotide sequence: TAT AGG GAC CTA TGT Which of the following mutations would cause a missense mutation in the sequence shown above? a. Replacement of first cytosine base with guanine base b. Replacement of final thymine base with guanine base c. Replacement of second guanine base with cytosine base d. Replacement of first thymine base with adenine baseSickle cell anemia is caused by a point mutation in the β-globin chain of hemoglobin. Glutamic acid is replaced by Valine. HBB sequence in normal adult hemoglobin (Hb A): Leu-Thr-Pro-Glu-Glu-Lys-Ser HBB sequence in mutant adult hemoglobin (Hb S): Leu-Thr-Pro-Val-Glu-Lys-Ser What effect does this mutation have on the structure and function of the protein? Predict what would happen to the RBC if the glutamic acid was replaced with asparagine instead of valine.
- A small section of a gene for a protein has the following nucleotide sequence: GGC TCG GTA ACA TACWhich of the following mutations would cause a silent mutation in the sequence shown above? Select one: a. Replacement of first cytosine base with guanine base b. Replacement of first thymine base with adenine base c. Replacement of second guanine base with cytosine base d. Replacement of second adenine base with thymine basehelp fill out the following illustration ..If the enzyme maltase has a Vo of 0.25 mM per minute when [S] = 0.10 mM, and a Vo of 0.40 mM perminute when [S] = 0.40 mM, what is its y-intercept on a Lineweaver-Burk plot?A. 0.10 minutes per mMB. 0.20 minutes per mMC. 0.50 minutes per mMD. 1.0 minutes per mME. 2.0 minutes per mM
- A small section of a gene for a protein has the following nucleotide sequence: CCT AAG GAT TCA CTT Which of the following mutations would cause a missense mutation in the sequence shown above? a. Replacement of first guanine base with cytosine base b. Replacement of first thymine base with cytosine base c. Replacement of second thymine base with adenine base d. Replacement of seond guanine base with adenine baseShown below are two homologous lengths of the alpha and betachains of human hemoglobin. Consult a genetic code dictionary and determine how many amino acid substitutionsmay have occurred as a result of a single nucleotidesubstitution. For any that cannot occur as a result of a singlechange, determine the minimal mutational distance. Alpha: ala val ala his val asp asp met proBeta: gly leu ala his leu asp asn leu lysIdentify the correct matched protein related disorder * (Please choose one correct answer only) A. Kwashiorkor: prominent presence of edema due to protein and calorie deficiency B. Prion disease occurs due to the presence of tau proteins causing neurofibrillary tangles inside neurons C. Sickle cell anemia as an example of a point mutation replacing glutamic acid with valine and lysine in one of the beta chains of hemoglobin D. Ehlers-Danlos syndrome and Osteogenesis Imperfecta may share the same defects of on the type of fibril forming collagen of the gene