Table 8.2: Transcription and translation of the first 7 codons in the B-globin chain of hemoglobin. Normal Sequence Mutated Sequence DNA DNA amino DNA DNA amino Codon MRNA Codon MRNA coding template strand coding template strand strand acid acid # code code strand sequence sequence G G 1 1 G G 2 A 2 A 3 3 G A A 4 4 C 5 G A G G 7 A 7 A G Shape of RBC Shape of RBC
Q: Which of the following is NOT true regarding the genetic code and translation? a) An mRNA is…
A: Deoxyribonucleic acid or DNA is a type of nucleic acid that is present in the nucleus of the cell.…
Q: What molecule catalyzes the formation of proteins
A: The protein synthesis process is a process where amino acids are formed by reading the frame of the…
Q: TRNA has peptidal transferase activity. True False Genetic information stored in mRNA is translated…
A: A ribosome is a biological unit made up of Protein molecules and RNA that functions as the cell's…
Q: Is the RNA-coding sequence likely to be from a bacterial cell or from a eukaryotic cell? How can you…
A: The mRNA coding sequence doesn't contain non coding part (intron). Introns are transcribed to…
Q: Rank the following in order of size: tRNA, DNA, mRNA.
A: A transfer RNA (tRNA) is an adaptor molecule composed of RNA, typically 76 to 90 nucleotides in…
Q: The genetic code is defined as a series of _______________ in _______________. (a) anticodons;…
A: The genetic code, anticodons, codons, mRNA, and tRNA are all involved in the expression of a gene. A…
Q: The drug, erythropoietin (EPO) is an artificial version of a protein that is naturally produced by…
A: DNA is the double-stranded molecule that is the genetic material in most animals except for some…
Q: Shown below is a codon in an mRNA. What is the correct sequence of the tRNA anticodon that…
A: The given messenger ribonucleic acid (mRNA) codon 5’-CAG-3’ codes for the amino acid glutamine.…
Q: A certain mRNA strand has the following nucleotide sequence: 5'—AUG—ACG—UAU—AAC—UUU—3' What is the…
A: DNA is the double-stranded molecule that is the genetic material in most animals except for some…
Q: Which of these are a DNA sequence are which are a protein? Column A Column B 1. A gene's promoter a.…
A: RNA polymerase - Enzyme used to convert DNA into mRNA. Introns - non-coding part of the gene. Exon -…
Q: The structure below is a fragment of what molecule? NH₂ NH, OP.OCH, OPOCH, oroc, QPOCH, O DNA ORNA O…
A: There are two kinds of nucleic acids DNA and RNA. DNA is double started molecules and RNA is a…
Q: Each ribosomal subunit is composed of a. multiple proteins. c. tRNA. b. rRNA. d. both a and b.
A: The rRNA or ribosomal RNA is involved in translation. The ribosomal protein along with the rRNA make…
Q: Codons are found on __________ and they contain __________ bases. a. tRNA, 4 b. mRNA, 3 c. tRNA, 3…
A: Codons are found on mRNA and they contain 3 bases. The genetic code is the stored genetic…
Q: What is the codon for the MRNA? DNA coding strand bases messenger RNA non-coding strand
A: There are four bases Adenine(A), Guanine(G), Cytosine(C), Uracil(C).
Q: Match the function in translation to each type of RNA (one RNA has two listed functions). 1) Carry…
A: The process where RNA transformed into protein called translation. There are all three types of…
Q: RNA molecules differ from DNA molecules in that they * a. are single stranded rather double…
A: Codon is a sequence of three DNA or RNA nucleotides. Codons encode the amino acids which eventually…
Q: Sickle cell anemia occurs due to a point mutation in a gene for hemoglobin protein. This mutation…
A: Sickle cell anemia occurs due to point mutation in a gene for hemoglobin. Its symptoms are - fatigue…
Q: Which type of RNA is used as a template to build protein during translation? MRNA rRNA tRNA SİRNA
A: RNA or Ribonucleic acid is a type of Nucleic acid and is one stranded structure that is synthesized…
Q: which of the following is mismatched a- small RNA catalyic with or without proteins b- rRNA 80% of…
A: RNA is coded from DNA with the help of RNA polymerase enzyme; the process of RNA synthesis is called…
Q: Anticodons pair with_____ . a. mRNA codons c. RNA anticodons b. DNA codons d. amino acids
A: Translation is the process by which proteins are formed in the cytoplasm using ribosomes and mRNA.…
Q: Match each statement below with the correct RNA molecule. A. rRNA B. mRNA C. tRNA D. uRNA…
A: mRNA contains the codons in the form of triplet of nucleotides during transcription and is…
Q: mRNA binds to a ribosome. Transcription completes. mRNA leaves the nucleus. tRNA attaches to the…
A: DNA translation is the term used to portray the course of protein synthesis by ribosomes in the…
Q: 3. DNA → TAC CTT GGG GAA TAT ACA CGC TGG CTT CGA TGA ATC CGT ACG GTA CTC GCC ATC MRNA → protein →
A: According to Bartleby guidelines, when multiple questions are posted we are allowed to answer the…
Q: In the diagram below (Figure 22), fill in the terms in the appropriate places indicated by a letter.…
A: This represents central dogma of molecular biology. It shows the flow of genetic information from…
Q: An MRNA has the codon 5' UAC 3'. What tRNA anticodon will bind to it? O a.5 CTA 3' O b.5 GUA 3
A: Every tRNA contains a trio of bases, called an anticodon, and ties at a space away from the trio to…
Q: The enzyme Aminoacyl tRNA synthetase
A:
Q: The genetic code is made of 3 RNA nucleotides read 3-->5' 3 RNA nucleotides read 5'-->3' 3 DNA…
A: In molecular biology, the central dogma controls the process of transcription in which DNA is…
Q: The coding strand of DNA in a segment of a gene is as follows: ATG GGC CTT AGC. This strand carries…
A: The DNA (deoxyribonucleic acid) duplex consists of a non-template and a template strand. The…
Q: Which of the following is true in translation? Codons on MRNA match to identical anticodons on tRNA…
A: DNA and RNA are nucleic acids present in the organisms. DNA is the deoxy ribose nucleic acid whereas…
Q: Which of the following statement about RNA is FALSE? rRNA is critical for protein synthesis as it is…
A: Ribonucleic acid (RNA) is a nucleic acid which has similar features to DNA and is found in all…
Q: ________ are encoded by a nucleotide triplet codon.
A: Answer - Option A - Amino acids
Q: Label the features of a tRNA by dragging the labels to the correct targets. A Binds an amino acid B.…
A: tRNA is also known as transfer RNA which helps in the transfer of amino acid to the mRNA codon…
Q: DNA 3’ AGA ACA TAA TAC CTC TTA ACA CTC TAA AGA CCA GCA ATT CGA TGA ACT GGA GCA 5’ mRNA protein
A: The transcription is the process by which mRNA is produced from the DNA full stop during the…
Q: What mRNA base sequences are complementary to the following DNA template sequences? Be sure to label…
A: The process by which the mRNA is transcribed from the parental DNA is known as the process of…
Q: Sickle cell anemia occurs due to a point mutation in a gené för changes the amino acid at position 6…
A: Red blood cells are small, round, and convex cells that transport oxygen throughout the body.…
Q: Which type of biological molocule is being made during this process? Incoming tRNA Bound NA to Amino…
A: The figure is showing the process of translation. Translation is the process of formation of a…
Q: Each one gives some basic information and summarizes its main role in translation. rRNA:…
A: The synthesis of protein or polypeptide chain from the mRNA sequence (that contain genetic codon) is…
Q: Which of the following molecules is used to transfer the genetic code from the nucleus to the…
A: Proteins are large biomolecules that play a significant role in the physiological activities of the…
Q: Below are the general steps of protein synthesis. What is the correct sequence of protein synthesis?…
A: DNA is the nucleic acids present in the organisms. DNA is the deoxy-ribose nucleic acid in which…
Q: This single stranded nucleic acid has anti codons TRNA MRNA. FRNA. DNA. glucose OOO
A: "Nucleic acid" is a term we use to describe certain large molecules in a cell. So they are actually…
Q: Which of the following choices best match the blank? Three-nucleotide segments of RNA called…
A: Amino acids are the monomers or structural units that are responsible for protein formation. The…
Q: A peptide bond connects the two ribosomal subunits. the amino acid to the TRNA. O two amino acids.…
A: In biological molecules, two main types of bonds are found that is covalent and non-covalent bonds.…
Q: There are two types of nucleic acids-DNA and RNA, both are composed of nucleotide subunits. Complete…
A: DNA and RNA are nucleic acids composed of nucleotide units. Each nucleotide is composed of a pentose…
Q: of the following determines the amino acid sequence of the protein produced during the process of…
A: DNA is the nucleic acids present in the organisms. DNA is the deoxy-ribose nucleic acid in which…
Q: The number of amino acids produced by translating the mRNA (3'AUGCUUAGUCGCGUA5') is : a. 4 b. 5…
A: The three letter codes for amino acids are the universally accepted amino acid codes that are…
Q: Which type of RNA best fits each of the statements below, respectively? MRNA, FRNA, MRNA, TRNA,…
A: RNA or the ribonucleic acid is a type of nucleic acid that is present in the cell usually…
Q: Below are the general steps of protein synthesis. What is the correct sequence of protein synthesis?…
A: The process of synthesis of proteins is called translation. Proteins are synthesised in a cell in…
Q: Which enzyme links amino acids together? (a) ribozyme (b) peptidyl transferase (c) DNA…
A: The organic compound that will combine and form the protein is called an amino acid. Amino acids are…
Q: 8. DNA → TAC AGA CGG CAA CTC TGG GTG CTT TGT TCT CTT CTC AGT ATC MRNA → protein >
A: The Central Dogma in molecular biology is one of the most important concepts which throws light on…
Q: Which of the following molecular structures contan codons? a protein B mRNA C. IRNA D. rRNA and C
A: The genetic material contains the genetic information. It passes the information from parents to…
Trending now
This is a popular solution!
Step by step
Solved in 3 steps with 1 images
- This is part of the Escherichia coli DNA sequence that contains an inverted repeat. (Note: top strand is the coding strand). 5'-AACGCATGAGAAAGCCCCCCGGAAGATCACCTTCCGGGGGCTTTATATAATTAGC-3' 3'-TTGCGTACTCTTTCGGGGGGCCTTCTAGTGGAAGGCCCCCGAAATATATTAATCG-5' (i) Draw the structure of hairpin loop that will be formed during the end of transcription. (ii) Describe the function of the hairpin loop during transcription.The sequence below is a template strand sequence for a gene (a very short one!). Identify the start codon and the amino acid sequence of this gene. Write your answer in 3 letter amino acid code. Put a hyphen between each amino acid. You should also include a description of any working or steps you have taken to determine your answer. 5' AGTCAGCAAGAAGACATCAGTGTTCCCATCTGT 3' Paragraph V B I U A = 8⁰ + v 11.From the mRNA base sequence CUU-AUG-GCU-UGG-CCC-UAA A.What anticodon sequences of tRNA’s are coded? B.What was the base sequence in the original DNA strand was made? Please answer completely will give rating surely Both questions answers needed
- Below is a sequence of DNA.5'-ttaccgataattctctctcccctcttccatgattctgattaaagaaggcgagaacgaaactatttgttaatacc-3' How many "reading frames" can be identified for this sequence? How many "open reading frames" can be identified for this sequence? What is the frame of the longest ORF? How many codons are in the longest ORF? What is the frame of the shortest ORF? How many AA are in the shortest ORF? Using the one letter code for Amino Acids, what is the predicted AA sequence of the shortestORF (from N to C-terminal end)? Using the one letter code for Amino Acids, what is the predicted AA sequence of the longestORF (from N to C-terminal end)?Below is a sequence of DNA. 5'-ttaccgataattctctctcccctcttccatgattctgattaaagaaggcgagaacgaaactatttgttaatacc-3' How many codons are in the longest ORF? What is the frame of the shortest ORF? How many AA are in the shortest ORF?6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…
- Below is the DNA sequence of a patient with overlapping genes (a single mRNA has multiple initiation points for translation) for two different proteins (DADαs and AMA): 5’- GTCCCAACCATGCCCACCGATCTTCCGCCTGCTTCTGAAGATGCGGGCCCAGGGAAATCTCTAACG-3’ 1. Indicate the DNA sequence coding for RNA. 2. Indicate the amino acid sequence of each of them.First Letter A G U с 22. Using the provided "Genetic Code-Reference" answer the following question. Based on the following DNA template strand, write out the amino acid chain produced. 23. Consider the following mRNA base codon sequence 5'-AUC-GAA-3' and the provided "Genetic Code-Reference". Genetic Code-Reference UUU UUC UUA UUG CUU CUC CUA CUG (mutated or silent) (mutated or silent) b. Briefly explain your reasoning for each. (be sure to include both parts) AULLY AUU a. Label which of the following would result in a mutated amino acid sequence or a silent mutation. (May help to first determine the original amino acid sequence, then compare to mutations) U Phe mRNA codon sequence: anticodon sequence: amino acid sequence: Leu Leu 5'-AUA-GAA-3' Val 5'- AUC-GAC-3' AUC Ille AUA AUAJ *AUG Met/Start GUU GUC GUA GUG UCU UCC UCA UCG) CCU) CCC ccc CCA 000 CCG ACU ACU ACC ACA ACG, C GCU GCC GCA GCG Second Letter Ser Pro Thr 3'-CAA-GTC-TGT-5' Ala UAU UAC) Tyr Туг A **UAA Stop UAG Stop CAU] CACJ…BM4_DNA AND PROTEIN S X /1FAIPQLSDP_g5B-629FSHNpGnTMIEppLS4A71zBd4vcUBqNUILubXONw/formResponse 4. What is the nitrogen base pair of Adenine in transcription? O Cytosine O Uracil O guanine O thymine 5. The central dogma of Molecular Biology states that There are four nitrogen bases in DNA, two purines (adenine and guanine) and two pyrimidines (cytosine and thymine). Which process is not included in the central dogma? duplication transcription translation O translocation Leadple
- III. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…Original DNA DNA Protein TACGCTATGAGC Methionine-Arginine-Tyrosine-Serine Mutation #1 DNA What type of mutation occurred? substitution insertion duplication deletion TACTCTATGAGCHistorial Marcadores Ventana Ayuda 0 Question 41 What is specifically illustrated in the figure below? Self- complementary sequence RNA polymerase DNA 5' 3' P つつつ 3' 5' RNA transcription A (4444 O carrollcc.instructure.com Edit View Insert Format Tools Table OO Hairpin loop (GC-rich) บบบบบบ 3′ RNA O е 12pt ✓ Paragraph | BIUA 2 T²V | V (LD) 5' ♫ tv A A Ċ 1 pts C T A